PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g07210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 421aa    MW: 46451.2 Da    PI: 6.7143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g07210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.22.4e-101444131
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                     +g W++eEde+l+++++++G g+W+++++  
  Vradi03g07210.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLA 44
                     678************************9975 PP

2Myb_DNA-binding42.21.8e-134891146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+++++E+  ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Vradi03g07210.1 48 RGAFSQQEENSIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 91
                     89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-14643IPR009057Homeodomain-like
SuperFamilySSF466892.81E-191289IPR009057Homeodomain-like
SMARTSM00717151345IPR001005SANT/Myb domain
PfamPF002499.6E-81443IPR001005SANT/Myb domain
CDDcd001671.53E-81790No hitNo description
PROSITE profilePS5129421.8764397IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-214597IPR009057Homeodomain-like
SMARTSM007172.0E-114795IPR001005SANT/Myb domain
PfamPF002491.9E-124892IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLADLKRGA FSQQEENSII  60
ELHAVLGNRW SQIAAQLPGR TDNEIKNLWN SCLKKKLRQR GIDPNTHQPL SEVENDKDKP  120
LTADRSNQKA SNEVSVIEPP KQKPITCTTS MPMDRYPLEV SATSKISGGG NNSSSTLDRF  180
GTCHDNNSSM ASSDMMGMGY FPFQHLNYGP NMGLTAANPN NTPLCFIPGS TSSQMMSELN  240
STMLHSVFST HVKPTVSLQS NNNNPSSIFS DGVQNWEGSA FSNNNNNNAS KSNGSSSCSI  300
QLQSSTNFLD HGSTITWGLQ AESATKTDNK DANSSHVVPL QSEAEDIKWS EYLNNTPFYL  360
GSTVQQHQTT HSLYSDEVKP ETGFIADESS TSWHHSQHFQ PSDIYSKDLQ RFSVAFGQSL  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1712975108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19298LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495198.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0L9U9640.0A0A0L9U964_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RZZ90.0A0A0S3RZZ9_PHAAN; Uncharacterized protein
STRINGGLYMA19G41250.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-88myb domain protein 61